PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00096208001
Common NameGSBRNA2T00096208001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 254aa    MW: 28533.2 Da    PI: 4.5465
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00096208001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.23.1e-373592461
               zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                         +a +cprC s+ntkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rk+ +s
  GSBRNA2T00096208001 35 TAPPCPRCASSNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNIPVGGGCRKRSRS 92
                         5668**************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-253486IPR003851Zinc finger, Dof-type
PfamPF027011.0E-313791IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.5283791IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MMLPYNAHNS YQHQFPSPEL EIPEKWKVPY GHDETAPPCP RCASSNTKFC YYNNYSLSQP  60
RYFCKGCRRY WTKGGSLRNI PVGGGCRKRS RSRNNSHKRF GRNENLQRDG LINQDEGSQS  120
SHAGSDIDLA AVFAQYVTNG SPSSTDNTTG SDQDSPLTTT TNHALDSLTW DICQETDVNL  180
GFYGTEKIQD GFGQFLQEDE EEMFEFQGLL DDKEIQEILD CAFSEEPDQL ISQGSFMING  240
DHWSSTDLAT FGI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18792KRSRSR
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00096208001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4934721e-146AB493472.1 Arabidopsis thaliana At1g21340 gene for hypothetical protein, partial cds, clone: RAAt1g21340.
GenBankAC0154471e-146AC015447.8 Arabidopsis thaliana chromosome I BAC F24J8 genomic sequence, complete sequence.
GenBankCP0026841e-146CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankDQ4462681e-146DQ446268.1 Arabidopsis thaliana clone pENTR221-At1g21340 Dof-type zinc finger domain-containing protein (At1g21340) mRNA, complete cds.
GenBankDQ6528471e-146DQ652847.1 Arabidopsis thaliana clone 0000013461_0000009694 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009149653.10.0PREDICTED: dof zinc finger protein DOF1.2
SwissprotP683491e-153DOF12_ARATH; Dof zinc finger protein DOF1.2
TrEMBLA0A078IJR10.0A0A078IJR1_BRANA; BnaA06g15080D protein
STRINGBra017906.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64622643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21340.11e-143Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]